PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02232.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 330aa    MW: 36946.5 Da    PI: 9.9965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02232.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94e-17108155148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc02232.1.g00040.1.am.mk 108 KGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 155
                                   79******************************99************97 PP

2Myb_DNA-binding34.93.5e-11161198147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T+eEdel+++++ +lG++        ++ gRt++++k++w+++
  Zmw_sc02232.1.g00040.1.am.mk 161 RGNFTEEEDELIIKLHSLLGNK--------LP-GRTDNEIKNYWNTH 198
                                   89******************99........**.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.807103159IPR017930Myb domain
SMARTSM007171.9E-13107157IPR001005SANT/Myb domain
SuperFamilySSF466895.75E-24107195IPR009057Homeodomain-like
PfamPF002496.8E-15108155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-23109162IPR009057Homeodomain-like
CDDcd001672.15E-10110155No hitNo description
PROSITE profilePS5129417.116160203IPR017930Myb domain
SMARTSM007175.4E-9160201IPR001005SANT/Myb domain
PfamPF002494.0E-9161198IPR001005SANT/Myb domain
CDDcd001672.02E-8163199No hitNo description
Gene3DG3DSA:1.10.10.604.4E-18163203IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAWSSHTQLA RASLAYLTLH LPEVPFHGRG PLSPLGDLPI QSSAYKIPRR FTHRSLASQQ  60
HQQQQPPLPC PALPCPALLR NPPRAQGKKA AAKGNQESII TGRAHTNKGA WTKEEDDRLV  120
AYIKAHGEGC WRSLPKAAGL LRCGKSCRLR WINYLRPDLK RGNFTEEEDE LIIKLHSLLG  180
NKLPGRTDNE IKNYWNTHIR RKLLSRGIDP VTHRPINEHA SNITISFEAA RDDKGAVFRR  240
EEPKVAAAIS RHEPPSHGNW GQGKPHKCPD LNLDLCISPP CQDEPMKPVK REAGLCFSCS  300
LGLPKSTDCK CSNFLGLRTA MLDFRSLEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2410720326128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957488.11e-142PREDICTED: myb-related protein Hv1
SwissprotP200261e-125MYB1_HORVU; Myb-related protein Hv1
TrEMBLA0A0A9D5311e-146A0A0A9D531_ARUDO; Myb31
STRINGSi030943m1e-142(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448